Siamese cats Collection

These structures can be used to show the affect of a frameshift mutation and to examine temperature sensitive mutations.

Read more about the biochemistry of melanin production.


Structures in the collection

Type Description Download structure
An MW Collection

Use the link on the right to download the collection.

Binary Data Siamese_cats.mwc
PubChem

Tyrosinase converts tyrosine to dopaquinone in the first step of the pathway for synthesizing melanin. 

Binary Data Tyrosine.sdf.gz
PubChem

Tyrosinase converts tyrosine to dopaquinone in the first step of the pathway for synthesizing melanin. 

Binary Data Dopaquinone.sdf.gz
PubChem

Dopaquinone is converted to melanin in the second step of the pathway for synthesizing melanin. 

Binary Data Melanin.sdf.gz
MMDB

This tryrosinase structure is from a bacteria, Bacillus megaterium.  The sequence is similar to the sequence of the tyrosinase protein in humans and other animals like cats and dogs.

Binary Data 4P6R-1.cn3
MMDB

This tryrosinase structure is identical to the other one from Bacillus. Use this for modeling.  

To show the affect of the delection, copy the sequence below, select it in the structure, and hide the unselected sequences.  Do this one row at a time.

KYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNA
AHMSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPSQSQIWSADF
MGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVL
Binary Data 4P6R-2.cn3

Privacy     |     Using Molecule World Images    |    Contact

2017 Digital World Biology®  ©Digital World Biology LLC. All rights reserved.